-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LAT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 95-262 of human LAT (NP_055202.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LAT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 95-262 of human LAT (NP_055202.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03724A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LAT |
| Target Synonyms | LAT1; pp36; IMD52; LAT | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 95-262 of human LAT (NP_055202.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN | Uniprot ID | O43561 |
Uniprot Id
O43561
Target Species
Human
Target Name
LAT
Target Full Name
Linker for activation of T-cells family member 1
Target Function
Required for TCR (T-cell antigen receptor)- and pre-TCR-mediated signaling, both in mature T-cells and during their development. Involved in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Couples activation of these receptors and their associated kinases with distal intracellular events such as mobilization of intracellular calcium stores, PKC activation, MAPK activation or cytoskeletal reorganization through the recruitment of PLCG1, GRB2, GRAP2, and other signaling molecules.
Target Involvement
Immunodeficiency 52 (IMD52)
Target Subcellular Location
Cell membrane; Single-pass type III membrane protein. Note=Present in lipid rafts.
Target Tissue Specificity
Expressed in thymus, T-cells, NK cells, mast cells and, at lower levels, in spleen. Present in T-cells but not B-cells (at protein level).
Target Synonyms
LAT; Linker for activation of T-cells family member 1; 36 kDa phospho-tyrosine adapter protein; pp36; p36-38
Target Background
The protein encoded by this gene is phosphorylated by ZAP-70/Syk protein tyrosine kinases following activation of the T-cell antigen receptor (TCR) signal transduction pathway. This transmembrane protein localizes to lipid rafts and acts as a docking site for SH2 domain-containing proteins. Upon phosphorylation, this protein recruits multiple adaptor proteins and downstream signaling molecules into multimolecular signaling complexes located near the site of TCR engagement. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification