Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PHF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-112 of human PHF6 (NP_115834.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PHF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-112 of human PHF6 (NP_115834.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03735A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PHF6 |
| Target Synonyms | BFLS; BORJ; CENP-31; PHF6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-112 of human PHF6 (NP_115834.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHYHCALHDK | Uniprot ID | Q8IWS0 |
Uniprot Id
Q8IWS0
Target Species
Human
Target Name
PHF6
Target Full Name
PHD finger protein 6
Target Function
Transcriptional regulator that associates with ribosomal RNA promoters and suppresses ribosomal RNA (rRNA) transcription.
Target Involvement
Boerjeson-Forssman-Lehmann syndrome (BFLS)
Target Subcellular Location
Nucleus. Nucleus, nucleolus. Chromosome, centromere, kinetochore. Note=Nuclear, it particularly localizes to the nucleolus.
Target Tissue Specificity
Ubiquitously expressed.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
AC004383.6; BFLS; BORJ; CENP 31; Centromere protein 31; MGC14797; OTTHUMP00000024063; PHD finger protein 6; PHD like zinc finger protein; PHD-like zinc finger protein; Phf6; PHF6_HUMAN
Target Background
This gene is a member of the plant homeodomain (PHD)-like finger (PHF) family. It encodes a protein with two PHD-type zinc finger domains, indicating a potential role in transcriptional regulation, that localizes to the nucleolus. Mutations affecting the coding region of this gene or the splicing of the transcript have been associated with Borjeson-Forssman-Lehmann syndrome (BFLS), a disorder characterized by cognitive disability, epilepsy, hypogonadism, hypometabolism, obesity, swelling of subcutaneous tissue of the face, narrow palpebral fissures, and large ears. Alternate splicing results in multiple transcript variants, encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
