-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFS6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-124 of human NDUFS6 (NP_004544.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NDUFS6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-124 of human NDUFS6 (NP_004544.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04027A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFS6 |
| Target Synonyms | MC1DN9; CI-13kA; CI13KDA; CI-13kD-A; NDUFS6 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat brain, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 29-124 of human NDUFS6 (NP_004544.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH | Uniprot ID | O75380 |
Uniprot Id
O75380
Target Species
Human
Target Name
NDUFS6
Target Full Name
NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Involvement
Mitochondrial complex I deficiency (MT-C1D)
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Target Protein Families
Complex I NDUFS6 subunit family
Target Synonyms
BC059730; CI 13kA; CI 13kD A ; CI-13kD-A; CI13KDA; Complex I 13kD A; Complex I 13kDa subunit A; Complex I mitochondrial respiratory chain 13 kD subunit; Complex I-13kD-A; IP13; MGC107676; NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH coenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron sulfur protein 6, mitochondrial; NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial; NADH ubiquinone oxidoreductase 13 kDa A subunit; NADH-ubiquinone oxidoreductase 13 kDa-A subunit; NADH:ubiquinone oxidoreductase NDUFS6 subunit; NADH:ubiquinone oxidoreductase subunit S6; Ndufs6; NDUS6_HUMAN
Target Background
This gene encodes a subunit of the NADH:ubiquinone oxidoreductase (complex I), which is the first enzyme complex in the electron transport chain of mitochondria. This complex functions in the transfer of electrons from NADH to the respiratory chain. The subunit encoded by this gene is one of seven subunits in the iron-sulfur protein fraction. Mutations in this gene cause mitochondrial complex I deficiency, a disease that causes a wide variety of clinical disorders, including neonatal disease and adult-onset neurodegenerative disorders.
Notification