-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VNN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-415 of human VNN1 (NP_004657.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VNN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-415 of human VNN1 (NP_004657.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04136A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VNN1 |
| Target Synonyms | HDLCQ8; Tiff66; VNN1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-431, HepG2, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 300-415 of human VNN1 (NP_004657.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLSQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKDLCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQICTLLKCKTTNLNTCGDSA | Uniprot ID | O95497 |
Uniprot Id
O95497
Target Species
Human
Target Name
VNN1
Target Full Name
Pantetheinase
Target Function
Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Protein Families
Carbon-nitrogen hydrolase superfamily, BTD/VNN family
Target Tissue Specificity
Widely expressed with higher expression in spleen, kidney and blood. Overexpressed in lesional psoriatic skin.
Target Synonyms
HDLCQ8; High density lipoprotein cholesterol level quantitative trait locus 8, included; Pantetheinase; Pantetheine hydrolase; Tiff66; V-1; Vanin 1; Vanin-1; Vannin 1; Vascular non inflammatory molecule 1; Vascular non-inflammatory molecule 1; VNN 1; VNN1; VNN1_HUMAN
Target Background
This gene encodes a member of the vanin family of proteins, which share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. No biotinidase activity has been demonstrated for any of the vanin proteins, however, they possess pantetheinase activity, which may play a role in oxidative-stress response. This protein, like its mouse homolog, is likely a GPI-anchored cell surface molecule. The mouse protein is expressed by the perivascular thymic stromal cells and regulates migration of T-cell progenitors to the thymus. This gene lies in close proximity to, and in the same transcriptional orientation as, two other vanin genes on chromosome 6q23-q24.
Notification