Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KREMEN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-360 of human KREMEN2 (NP_078783.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KREMEN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-360 of human KREMEN2 (NP_078783.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04569A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KREMEN2 |
| Target Synonyms | KRM2; KREMEN2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-360 of human KREMEN2 (NP_078783.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASGSLLRAFDGARPPPSGPLRLGTAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGANVSCSPRPGA | Uniprot ID | Q8NCW0 |
Uniprot Id
Q8NCW0
Target Species
Human
Target Name
KREMEN2
Target Full Name
Kremen protein 2
Target Function
Receptor for Dickkopf proteins. Cooperates with DKK1/2 to inhibit Wnt/beta-catenin signaling by promoting the endocytosis of Wnt receptors LRP5 and LRP6. Plays a role in limb development; attenuates Wnt signaling in the developing limb to allow normal limb patterning and can also negatively regulate bone formation.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Synonyms
Dickkopf receptor 2; KREM2_HUMAN; KREMEN 2; Kremen protein 2; Kremen protein 2 precursor; Kremen2; Kringle containing protein marking the eye and the nose; Kringle containing transmembrane protein 2; Kringle domain containing transmembrane protein 2; Kringle domain-containing transmembrane protein 2; Kringle-containing protein marking the eye and the nose; KRM 2; KRM2; MGC10791; MGC16709
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
