Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATPAF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 41-200 of human ATPAF2 (NP_663729.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATPAF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 41-200 of human ATPAF2 (NP_663729.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04736A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATPAF2 |
| Target Synonyms | ATP12; ATP12p; LP3663; MC5DN1; ATPAF2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 41-200 of human ATPAF2 (NP_663729.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APPTERKRFYQNVSITQGEGGFEINLDHRKLKTPQAKLFTVPSEALAIAVATEWDSQQDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKTREVLVSHLASYN | Uniprot ID | Q8N5M1 |
Uniprot Id
Q8N5M1
Target Species
Human
Target Name
ATPAF2
Target Full Name
ATP synthase mitochondrial F1 complex assembly factor 2
Target Function
May play a role in the assembly of the F1 component of the mitochondrial ATP synthase (ATPase).
Target Involvement
Mitochondrial complex V deficiency, nuclear 1 (MC5DN1)
Target Subcellular Location
Mitochondrion.
Target Protein Families
ATP12 family
Target Tissue Specificity
Widely expressed.
Target Research Area
Metabolism
Target Synonyms
ATPAF2; ATP12; LP3663ATP synthase mitochondrial F1 complex assembly factor 2; ATP12 homolog
Target Background
This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 alpha subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. This gene is located within the Smith-Magenis syndrome region on chromosome 17. An alternatively spliced transcript variant has been described, but its biological validity has not been determined.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
