-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ABR (NP_001243776.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ABR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ABR (NP_001243776.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04933A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABR |
| Target Synonyms | MDB; ABR | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus, Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ABR (NP_001243776.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV | Uniprot ID | Q12979 |
Uniprot Id
Q12979
Target Species
Human
Target Name
ABR
Target Full Name
Active breakpoint cluster region-related protein
Target Function
Protein with a unique structure having two opposing regulatory activities toward small GTP-binding proteins. The C-terminus is a GTPase-activating protein domain which stimulates GTP hydrolysis by RAC1, RAC2 and CDC42. Accelerates the intrinsic rate of GTP hydrolysis of RAC1 or CDC42, leading to down-regulation of the active GTP-bound form. The central Dbl homology (DH) domain functions as guanine nucleotide exchange factor (GEF) that modulates the GTPases CDC42, RHOA and RAC1. Promotes the conversion of CDC42, RHOA and RAC1 from the GDP-bound to the GTP-bound form. Functions as an important negative regulator of neuronal RAC1 activity. Regulates macrophage functions such as CSF-1 directed motility and phagocytosis through the modulation of RAC1 activity.
Target Subcellular Location
Cell projection, dendritic spine. Cell projection, axon. Cell junction, synapse.
Target Tissue Specificity
Highly enriched in the brain. Much weaker expression in heart, lung and muscle.
Target Synonyms
abr; ABR_HUMAN; Active BCR related; Active BCR related gene; Active breakpoint cluster region related protein; Active breakpoint cluster region-related protein; MDB
Target Background
This gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.
Notification