Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WARS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 211-360 of human WARS2 (NP_056651.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against WARS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 211-360 of human WARS2 (NP_056651.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05099A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WARS2 |
| Target Synonyms | TrpRS; PKDYS3; NEMMLAS; mtTrpRS; WARS2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 211-360 of human WARS2 (NP_056651.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LTSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTDFTSEVTYDPAGRAGVSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVGFL | Uniprot ID | Q9UGM6 |
Uniprot Id
Q9UGM6
Target Species
Human
Target Name
WARS2
Target Full Name
Tryptophan--tRNA ligase, mitochondrial
Target Function
Mitochondrial aminoacyl-tRNA synthetase that activate and transfer the amino acids to their corresponding tRNAs during the translation of mitochondrial genes and protein synthesis.
Target Involvement
Neurodevelopmental disorder, mitochondrial, with abnormal movements and lactic acidosis, with or without seizures (NEMMLAS)
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Class-I aminoacyl-tRNA synthetase family
Target Tissue Specificity
Brain.
Target Synonyms
WARS2; Tryptophan--tRNA ligase; mitochondrial; EC 6.1.1.2;; Mt)TrpRS; Tryptophanyl-tRNA synthetase; TrpRS
Target Background
Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. This gene encodes the mitochondrial tryptophanyl-tRNA synthetase. Two alternative transcripts encoding different isoforms have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
