Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC25A44 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-184 of human SLC25A44 (NP_055470.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC25A44 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-184 of human SLC25A44 (NP_055470.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05107A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC25A44 |
| Target Synonyms | SLC25A44 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 140-184 of human SLC25A44 (NP_055470.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLRGFYR | Uniprot ID | Q96H78 |
Uniprot Id
Q96H78
Target Species
Human
Target Name
SLC25A44
Target Full Name
Solute carrier family 25 member 44
Target Function
Mitochondrial solute transporter which transports branched-chain amino acid (BCAA; valine, leucine and isoleucine) into mitochondria in brown adipose tissue (BAT). BAT is involved in BCAA catabolism and actively utilizes BCAA in the mitochondria for thermogenesis.
Target Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Target Protein Families
Mitochondrial carrier (TC 2.A.29) family
Target Synonyms
SLC25A44; KIAA0446; Solute carrier family 25 member 44
Target Background
SLC25A44 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
