-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 62-181 of human ARL1 (NP_001168.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ARL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 62-181 of human ARL1 (NP_001168.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05182A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARL1 |
| Target Synonyms | ARFL1; ARL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, Mouse brain, Mouse thymus | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 62-181 of human ARL1 (NP_001168.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ | Uniprot ID | P40616 |
Uniprot Id
P40616
Target Species
Human
Target Name
ARL1
Target Full Name
ADP-ribosylation factor-like protein 1
Target Function
GTP-binding protein that recruits several effectors, such as golgins, arfaptins and Arf-GEFs to the trans-Golgi network, and modulates their functions at the Golgi complex. Plays thereby a role in a wide range of fundamental cellular processes, including cell polarity, innate immunity, or protein secretion mediated by arfaptins, which were shown to play a role in maintaining insulin secretion from pancreatic beta cells.
Target Subcellular Location
Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side. Golgi apparatus, trans-Golgi network membrane. Membrane; Lipid-anchor.
Target Protein Families
Small GTPase superfamily, Arf family
Target Tissue Specificity
Detected in heart, liver, lung and liver (at protein level). Detected in fetal heart, lung, liver and kidney. Detected in adult heart, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Target Synonyms
ADP ribosylation factor like 1; ADP-ribosylation factor-like protein 1; ARFL1; Arl1; ARL1_HUMAN
Target Background
The protein encoded by this gene belongs to the ARL (ADP-ribosylation factor-like) family of proteins, which are structurally related to ADP-ribosylation factors (ARFs). ARFs, described as activators of cholera toxin (CT) ADP-ribosyltransferase activity, regulate intracellular vesicular membrane trafficking, and stimulate a phospholipase D (PLD) isoform. Although, ARL proteins were initially thought not to activate CT or PLD, later work showed that they are weak stimulators of PLD and CT in a phospholipid dependent manner. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification