Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSPA12B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 552-686 of human HSPA12B (NP_443202.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HSPA12B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 552-686 of human HSPA12B (NP_443202.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05216A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSPA12B |
| Target Synonyms | C20orf60; HSPA12B | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 552-686 of human HSPA12B (NP_443202.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VPGRHPPEKLLVRDGRRWCTDVFERFVAAEQSVALGEEVRRSYCPARPGQRRVLINLYCCAAEDARFITDPGVRKCGALSLELEPADCGQDTAGAPPGRREIRAAMQFGDTEIKVTAVDVSTNRSVRASIDFLSN | Uniprot ID | Q96MM6 |
Uniprot Id
Q96MM6
Target Species
Human
Target Name
HSPA12B
Target Full Name
Heat shock 70 kDa protein 12B
Target Synonyms
Heat shock 70 kDa protein 12B; HS12B_HUMAN; Hspa12b
Target Background
The protein encoded by this gene contains an atypical heat shock protein 70 (Hsp70) ATPase domain and is therefore a distant member of the mammalian Hsp70 family. This gene may be involved in susceptibility to atherosclerosis. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
