-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RBX1 (NP_055063.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RBX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RBX1 (NP_055063.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05597A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBX1 |
| Target Synonyms | ROC1; RNF75; BA554C12.1; RBX1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RBX1 (NP_055063.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNRE | Uniprot ID | P62877 |
Uniprot Id
P62877
Target Species
Human
Target Name
RBX1
Target Full Name
E3 ubiquitin-protein ligase RBX1
Target Function
E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair. CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets. The functional specificity of the E3 ubiquitin-protein ligase complexes depends on the variable substrate recognition components. As a component of the CSA complex promotes the ubiquitination of ERCC6 resulting in proteasomal degradation. Recruits the E2 ubiquitin-conjugating enzyme CDC34 to the complex and brings it into close proximity to the substrate. Probably also stimulates CDC34 autoubiquitination. May be required for histone H3 and histone H4 ubiquitination in response to ultraviolet and for subsequent DNA repair. Promotes the neddylation of CUL1, CUL2, CUL4 and CUL4 via its interaction with UBE2M. Involved in the ubiquitination of KEAP1, ENC1 and KLHL41. In concert with ATF2 and CUL3, promotes degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
RING-box family
Target Tissue Specificity
Widely expressed.
Target Research Area
Cell Biology
Target Synonyms
BA554C12.1; E3 ubiquitin-protein ligase RBX1; FLJ60363; MGC13357; MGC1481; OTTHUMP00000028983; Protein ZYP; Rbx 1; Rbx1; RBX1_HUMAN; Regulator of cullins 1; Ring box 1; Ring box 1 E3 ubiquitin protein ligase; RING box protein 1; RING finger protein 75; RING finger protein; RING-box protein 1; Ringbox protein 1 ; RNF 75; RNF75; ROC 1; ROC1; ZYP protein
Target Background
This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5.
Notification