-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP12A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 890-980 of human ATP12A (NP_001172014.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATP12A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 890-980 of human ATP12A (NP_001172014.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05685A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP12A |
| Target Synonyms | HK; ATP1AL1; H-K-ATPase; ATP12A | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-431 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 890-980 of human ATP12A (NP_001172014.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YFTVYAQEGFLPRTLINLRVEWEKDYVNDLKDSYGQEWTRYQREYLEWTGYTAFFVGILVQQIADLIIRKTRRNSIFQQGLFRNKVIWVGI | Uniprot ID | P54707 |
Uniprot Id
P54707
Target Species
Human
Target Name
ATP12A
Target Full Name
Potassium-transporting ATPase alpha chain 2
Target Function
The catalytic subunit of a H(+)/K(+) ATPase and/or Na(+)/K(+) ATPase pump which transports K(+) ions in exchange for Na(+) and/or H(+) ions across the apical membrane of epithelial cells. Uses ATP as an energy source to pump K(+) ions into the cell while transporting Na(+) and/or H(+) ions to the extracellular compartment. Involved in the maintenance of electrolyte homeostasis through K(+) ion absorption in kidney and colon. In the airway epithelium, may play a primary role in mucus acidification regulating its viscosity and clearance.
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein.
Target Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IIC subfamily
Target Tissue Specificity
Expressed in airway epithelial cells (at protein level). Found in skin and kidney. Detected in prostate basal cells (at protein level). Expression is increased in benign prostate hyperplasia and tumor tissues (at protein level).
Target Synonyms
ATP12A; ATP1AL1Potassium-transporting ATPase alpha chain 2; EC 7.2.2.19; Non-gastric H(+)/K(+) ATPase subunit alpha; Proton pump
Target Background
The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This gene encodes a catalytic subunit of the ouabain-sensitive H+/K+ -ATPase that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for potassium absorption in various tissues. Two transcript variants encoding different isoforms have been found for this gene.
Notification