Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NOP58 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-529 of human NOP58 (NP_057018.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NOP58 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-529 of human NOP58 (NP_057018.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05835A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOP58 |
| Target Synonyms | NOP5; HSPC120; NOP5/NOP58; NOP58 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A375, HepG2, Jurkat, K-562, Mouse brain, Mouse liver, Rat liver, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 360-529 of human NOP58 (NP_057018.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED | Uniprot ID | Q9Y2X3 |
Uniprot Id
Q9Y2X3
Target Species
Human
Target Name
NOP58
Target Full Name
Nucleolar protein 58
Target Function
Required for 60S ribosomal subunit biogenesis. Core component of box C/D small nucleolar ribonucleoprotein (snoRNP) particles. Required for the biogenesis of box C/D snoRNAs such as U3, U8 and U14 snoRNAs.
Target Subcellular Location
Nucleus, nucleolus. Nucleus, nucleoplasm.
Target Protein Families
NOP5/NOP56 family
Target Tissue Specificity
Ubiquitous.
Target Research Area
Metabolism
Target Synonyms
HSPC120; NOL5; NOP5; NOP5/NOP58; NOP58; NOP58 ribonucleoprotein homolog (yeast); NOP58 ribonucleoprotein homolog; NOP58_HUMAN; Nucleolar protein 5; Nucleolar protein 58; Nucleolar protein NOP5/NOP58
Target Background
The protein encoded by this gene is a core component of box C/D small nucleolar ribonucleoproteins. Some box C/D small nucleolar RNAs (snoRNAs), such as U3, U8, and U14, are dependent upon the encoded protein for their synthesis. This protein is SUMOylated, which is necessary for high affinity binding to snoRNAs.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
