Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HOXA13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-320 of human HOXA13 (NP_000513.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HOXA13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-320 of human HOXA13 (NP_000513.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05896A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HOXA13 |
| Target Synonyms | HOX1; HOX1J; HOXA13 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 140-320 of human HOXA13 (NP_000513.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GPAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPHPNAIKSCAQPASAAAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSYR | Uniprot ID | P31271 |
Uniprot Id
P31271
Target Species
Human
Target Name
HOXA13
Target Full Name
Homeobox protein Hox-A13
Target Function
Sequence-specific, AT-rich binding transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.; Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Target Involvement
Hand-foot-genital syndrome (HFG); Guttmacher syndrome (GUTTS)
Target Subcellular Location
Nucleus.
Target Protein Families
Abd-B homeobox family
Target Synonyms
Homeo box 1J; Homeo box A13; Homeobox 1J; Homeobox A13; Homeobox protein Hox A13; Homeobox protein Hox-1J; Homeobox protein Hox-A13; Homeobox protein HOXA13; Homeobox1J; HomeoboxA13; HOX 1; HOX 1J; Hox 1J protein; HOX A13; HOX1; HOX1J; HOXA 13; HOXA13; HXA13_HUMAN; Transcription factor HOXA13
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
