Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRMP5/DPYSL5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 445-564 of human CRMP5/CRMP5/DPYSL5 (NP_064519.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CRMP5/DPYSL5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 445-564 of human CRMP5/CRMP5/DPYSL5 (NP_064519.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05960A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRMP5/DPYSL5 |
| Target Synonyms | CV2; CRAM; CRMP5; RTSC4; Ulip6; CRMP-5; CRMP5/DPYSL5 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 445-564 of human CRMP5/CRMP5/DPYSL5 (NP_064519.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW | Uniprot ID | Q9BPU6 |
Uniprot Id
Q9BPU6
Target Species
Human
Target Name
DPYSL5
Target Full Name
Dihydropyrimidinase-related protein 5
Target Function
May have a function in neuronal differentiation and/or axon growth.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Metallo-dependent hydrolases superfamily, Hydantoinase/dihydropyrimidinase family
Target Synonyms
Collapsin response mediator protein 5; CRAM; CRMP 3 associated molecule; CRMP 5; CRMP3 associated molecule; Dihydropyrimidinase like 5; Dihydropyrimidinase related protein 5; Dihydropyrimidinase-related protein 5; DPYL5_HUMAN; DPYS L5; DPYSL 5; DPYSL5; DRP 5; DRP5; FLJ45383; Ulip 6; Ulip6; ULIP6 protein; UNC33-like phosphoprotein 6
Target Background
This gene encodes a member of the CRMP (collapsing response mediator protein) family thought to be involved in neural development. Antibodies to the encoded protein were found in some patients with neurologic symptoms who had paraneoplastic syndrome. A pseudogene of this gene is found on chromosome 11. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
