Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAGEH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human MAGEH1 (NP_054780.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MAGEH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human MAGEH1 (NP_054780.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06049A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAGEH1 |
| Target Synonyms | APR1; APR-1; MAGEH; MAGEH1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human MAGEH1 (NP_054780.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RRNARAAEENRNNRKIQASEASETPMAASVVASTPEDDLSGPEEDPSTPEEASTTPEEASSTAQAQKPSVPRSNFQGTKKS | Uniprot ID | Q9H213 |
Uniprot Id
Q9H213
Target Species
Human
Target Name
MAGEH1
Target Full Name
Melanoma-associated antigen H1
Target Synonyms
MAGEH1; APR1; Melanoma-associated antigen H1; Apoptosis-related protein 1; APR-1; MAGE-H1 antigen; Restin
Target Background
This gene belongs to the non-CT (non cancer/testis) subgroup of the melanoma-associated antigen (MAGE) superfamily. The encoded protein is likely associated with apoptosis, cell cycle arrest, growth inhibition or cell differentiation. The protein may be involved in the atRA (all-trans retinoic acid) signaling through the STAT1-alpha (signal transducer and activator of transcription 1-alpha) pathway.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
