Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPP1R3C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human PPP1R3C (NP_005389.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against PPP1R3C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human PPP1R3C (NP_005389.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
Immunohistochemistry analysis of paraffin-embedded Rat kidney using PPP1R3C antibody at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Cat.No | ADA-06366A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPP1R3C |
| Target Synonyms | PTG; PPP1R5; PPP1R3C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human PPP1R3C (NP_005389.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSCTRMIQVLDPRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLNDISSALKHHEEKNLILDFPQPSTDYLSFRS | Uniprot ID | Q9UQK1 |
Uniprot Id
Q9UQK1
Target Species
Human
Target Name
PPP1R3C
Target Full Name
Protein phosphatase 1 regulatory subunit 3C
Target Function
Acts as a glycogen-targeting subunit for PP1 and regulates its activity. Activates glycogen synthase, reduces glycogen phosphorylase activity and limits glycogen breakdown. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in a variety of cell types.
Target Synonyms
OTTHUMP00000020089; Phosphatase 1, regulatory inhibitor subunit 5; PP1 subunit R5; ppp1r3c; PPP1R5; PPR3C_HUMAN; Protein phosphatase 1 inhibitor 3C; Protein phosphatase 1 regulatory subunit 3C; Protein phosphatase 1 regulatory subunit 5; protein phosphatase 1, regulatory (inhibitor) subunit 3C; Protein targeting to glycogen; PTG; R5
Target Background
This gene encodes a carbohydrate binding protein that is a subunit of the protein phosphatase 1 (PP1) complex. PP1 catalyzes reversible protein phosphorylation, which is important in a wide range of cellular activities. The encoded protein affects glycogen biosynthesis by activating glycogen synthase and limiting glycogen breakdown by reducing glycogen phosphorylase activity. DNA hypermethylation of this gene has been found in colorectal cancer patients. The encoded protein also interacts with the laforin protein, which is a protein tyrosine phosphatase implicated in Lafora disease.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
