-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRHR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-140 of human CRHR2 (NP_001189404.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CRHR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-140 of human CRHR2 (NP_001189404.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06390A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRHR2 |
| Target Synonyms | CRF2; CRFR2; CRF-RB; HM-CRF; CRHR2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, B cells, Mouse brain, Mouse lung, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-140 of human CRHR2 (NP_001189404.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPPLQYAAGQSQMPKDQPLWALLEQYCHTIMTLTNLSGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHY | Uniprot ID | Q13324 |
Uniprot Id
Q13324
Target Species
Human
Target Name
CRHR2
Target Full Name
Corticotropin-releasing factor receptor 2
Target Function
G-protein coupled receptor for CRH (corticotropin-releasing factor), UCN (urocortin), UCN2 and UCN3. Has high affinity for UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 2 family
Target Synonyms
CRHR2; CRF2R; CRH2R; Corticotropin-releasing factor receptor 2; CRF-R-2; CRF-R2; CRFR-2; Corticotropin-releasing hormone receptor 2; CRH-R-2; CRH-R2
Target Background
The protein encoded by this gene belongs to the G-protein coupled receptor 2 family, and the subfamily of corticotropin releasing hormone receptor. This receptor shows high affinity for corticotropin releasing hormone (CRH), and also binds CRH-related peptides such as urocortin. CRH is synthesized in the hypothalamus, and plays an important role in coordinating the endocrine, autonomic, and behavioral responses to stress and immune challenge. Studies in mice suggest that this receptor maybe involved in mediating cardiovascular homeostasis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Notification