-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OPN4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 365-489 of human OPN4 (NP_001025186.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against OPN4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 365-489 of human OPN4 (NP_001025186.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06677A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OPN4 |
| Target Synonyms | MOP; OPN4 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 365-489 of human OPN4 (NP_001025186.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HPKYRVAIAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGWTHMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM | Uniprot ID | Q9UHM6 |
Uniprot Id
Q9UHM6
Target Species
Human
Target Name
OPN4
Target Full Name
Melanopsin
Target Function
Photoreceptor that binds cis-retinaldehydes. Contributes to pupillar reflex, photoentrainment and other non-image forming responses to light. May be involved in the optokinetic visual tracking response. May be involved in the regulation of retinal hyaloid vessel growth and regression.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, axon. Cell projection, dendrite. Perikaryon.
Target Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Target Tissue Specificity
Expressed in the retina.
Target Synonyms
OPN4; MOP; Melanopsin; Opsin-4
Target Background
Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. This gene encodes a photoreceptive opsin protein that is expressed within the ganglion and amacrine cell layers of the retina. In mouse, retinal ganglion cell axons expressing this gene projected to the suprachiasmatic nucleus and other brain nuclei involved in circadian photoentrainment. In mouse, this protein is coupled to a transient receptor potential (TRP) ion channel through a G protein signaling pathway and produces a physiologic light response via membrane depolarization and increased intracellular calcium. The protein functions as a sensory photopigment and may also have photoisomerase activity. Experiments with knockout mice indicate that this gene attenuates, but does not abolish, photoentrainment. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification