Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human TAF3 (NP_114129.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TAF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human TAF3 (NP_114129.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06710A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAF3 |
| Target Synonyms | TAF140; TAFII140; TAFII-140; TAF3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, K-562, Mouse brain, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TAF3 (NP_114129.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HRYSELYGRTDPILDDVGEAFQLMGVSLHELEDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEERKEYIPDYLPPIVSSQEEEEEEQVPTDGGTS | Uniprot ID | Q5VWG9 |
Uniprot Id
Q5VWG9
Target Species
Human
Target Name
TAF3
Target Full Name
Transcription initiation factor TFIID subunit 3
Target Function
Transcription factor TFIID is one of the general factors required for accurate and regulated initiation by RNA polymerase II. TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. Required in complex with TBPL2 for the differentiation of myoblasts into myocytes. The complex replaces TFIID at specific promoters at an early stage in the differentiation process.
Target Subcellular Location
Nucleus.
Target Protein Families
TAF3 family
Target Synonyms
140 kDa TATA box-binding protein-associated factor; Bip2 protein; RNA polymerase II transcription factor TAFII140; TAF(II)140; TAF140; TAF3; TAF3 RNA polymerase II TATA box binding protein (TBP)-associated factor; TAF3_HUMAN; TAFII-140; TAFII140; TAFII155 protein ; TATA box binding protein associated factor 3; TBP-associated factor 3; Transcription initiation factor TFIID 140 kDa subunit; Transcription initiation factor TFIID subunit 3
Target Background
The highly conserved RNA polymerase II transcription factor TFIID (see TAF1; MIM 313650) comprises the TATA box-binding protein (TBP; MIM 600075) and a set of TBP-associated factors (TAFs), including TAF3. TAFs contribute to promoter recognition and selectivity and act as antiapoptotic factors (Gangloff et al., 2001 [PubMed 11438666]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
