Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SSR3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-145 of human SSR3 (NP_009038.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SSR3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-145 of human SSR3 (NP_009038.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06853A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SSR3 |
| Target Synonyms | TRAPG; SSR3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, BxPC-3, Jurkat, K-562, Mouse pancreas, Mouse uterus, Rat pancreas, Rat uterus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 70-145 of human SSR3 (NP_009038.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLF | Uniprot ID | Q9UNL2 |
Uniprot Id
Q9UNL2
Target Species
Human
Target Name
SSR3
Target Full Name
Translocon-associated protein subunit gamma
Target Function
TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
TRAP-gamma family
Target Synonyms
SSR3; TRAPG; Translocon-associated protein subunit gamma; TRAP-gamma; Signal sequence receptor subunit gamma; SSR-gamma
Target Background
The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR is comprised of four membrane proteins/subunits: alpha, beta, gamma, and delta. The first two are glycosylated subunits and the latter two are non-glycosylated subunits. This gene encodes the gamma subunit, which is predicted to span the membrane four times.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
