Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RMND1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 13-200 of human RMND1 (NP_060379.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RMND1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 13-200 of human RMND1 (NP_060379.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06858A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RMND1 |
| Target Synonyms | RMD1; C6orf96; COXPD11; bA351K16; bA351K16.3; RMND1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 13-200 of human RMND1 (NP_060379.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HHILSKAHQCRRIGHLMLKPLKEFENTTCSTLTIRQSLDLFLPDKTASGLNKSQILEMNQKKSDTSMLSPLNAARCQDEKAHLPTMKSFGTHRRVTHKPNLLGSKWFIKILKRHFSSVSTETFVPKQDFPQVKRPLKASRTRQPSRTNLPVLSVNEDLMHCTAFATADEYHLGNLSQDLASHGYVEVT | Uniprot ID | Q9NWS8 |
Uniprot Id
Q9NWS8
Target Species
Human
Target Name
RMND1
Target Full Name
Required for meiotic nuclear division protein 1 homolog
Target Function
Required for mitochondrial translation, possibly by coordinating the assembly or maintenance of the mitochondrial ribosome.
Target Involvement
Combined oxidative phosphorylation deficiency 11 (COXPD11)
Target Subcellular Location
Mitochondrion.
Target Protein Families
RMD1/sif2 family
Target Synonyms
bA351K16; bA351K16.3; C6orf96; chromosome 6 open reading frame 96; FLJ20627; MGC117362; MGC149570; MGC882602; required for meiotic nuclear division 1 homolog (S. cerevisiae); Required for meiotic nuclear division protein 1 homolog; Rmnd1; RMND1_HUMAN
Target Background
The protein encoded by this gene belongs to the evolutionary conserved sif2 family of proteins that share the DUF155 domain in common. This protein is thought to be localized in the mitochondria and involved in mitochondrial translation. Mutations in this gene are associated with combined oxidative phosphorylation deficiency-11. Alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
