-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TUB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-230 of human TUB (NP_003311.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TUB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-230 of human TUB (NP_003311.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06931A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TUB |
| Target Synonyms | rd5; RDOB; TUB | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | PC-3, U-251MG, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 130-230 of human TUB (NP_003311.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSSSGSTSYQVQEADSLASVQLGATRPTAPASAKRTKAAATAGGQGGAARKEKKGKHKGTSGPAALAEDKSEAQGPVQILTVGQSDHAQDAGETAAGGGER | Uniprot ID | P50607 |
Uniprot Id
P50607
Target Species
Human
Target Name
TUB
Target Full Name
Tubby protein homolog
Target Function
Functions in signal transduction from heterotrimeric G protein-coupled receptors. Binds to membranes containing phosphatidylinositol 4,5-bisphosphate. Can bind DNA (in vitro). May contribute to the regulation of transcription in the nucleus. Could be involved in the hypothalamic regulation of body weight. Contribute to stimulation of phagocytosis of apoptotic retinal pigment epithelium (RPE) cells and macrophages.
Target Involvement
Retinal dystrophy and obesity (RDOB)
Target Subcellular Location
Cytoplasm. Nucleus. Secreted. Cell membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
TUB family
Target Synonyms
F10B5.4; rd5; TUB 1; TUB; TUB_HUMAN; Tubby homologue; Tubby protein homolog 1; Tubby protein homolog
Target Background
This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.
Notification