Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TXLNA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TXLNA (NP_787048.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TXLNA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TXLNA (NP_787048.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06941A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TXLNA |
| Target Synonyms | IL14; TXLN; TXLNA | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, HepG2, Jurkat | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TXLNA (NP_787048.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQ | Uniprot ID | P40222 |
Uniprot Id
P40222
Target Species
Human
Target Name
TXLNA
Target Full Name
Alpha-taxilin
Target Function
May be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis in neuroendocrine cells.
Target Protein Families
Taxilin family
Target Tissue Specificity
Ubiquitous, with much higher expression in heart, kidney, liver and pancreas.
Target Synonyms
Alpha-taxilin; DKFZp451J0118; IL 14; IL14; interleukin 14; MGC11887; MGC118870; MGC118871; RP4-622L5.4; Taxilin alpha; TXLN; TXLNA; TXLNA_HUMAN
Target Background
Predicted to enable syntaxin binding activity. Predicted to be involved in exocytosis. Predicted to act upstream of or within B cell activation. Located in cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
