Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HEMGN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HEMGN (NP_932095.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HEMGN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HEMGN (NP_932095.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07047A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HEMGN |
| Target Synonyms | NDR; EDAG; CT155; EDAG-1; HEMGN | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, BxPC-3, HepG2, Mouse spleen, SP2/0 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HEMGN (NP_932095.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGKGNRRGRKRQQNTELKVEPQPQIEKEIVEKA | Uniprot ID | Q9BXL5 |
Uniprot Id
Q9BXL5
Target Species
Human
Target Name
HEMGN
Target Full Name
Hemogen
Target Function
Regulates the proliferation and differentiation of hematopoietic cells. Overexpression block the TPA-induced megakaryocytic differentiation in the K562 cell model. May also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB).
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in hematopoietic precursor cells, thyroid and spermatids (at protein level). Expressed in bone marrow, testis, thymus. Expressed in prostate cancer and ovarian cancer. Also expressed in thymus and thyroid tumors, non-Hodgkin lymphoma, various le
Target Synonyms
CT155; EDAG; EDAG-1; Erythroid differentiation-associated gene protein; Hemgn; HEMGN_HUMAN; Hemogen; Hemopoietic gene protein; NDR; Negative differentiation regulator protein
Target Background
Predicted to be involved in regulation of osteoblast differentiation. Located in nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
