Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NOL10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human NOL10 (NP_079170.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NOL10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human NOL10 (NP_079170.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07112A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOL10 |
| Target Synonyms | PQBP5; NOL10 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, Mouse spleen, Mouse testis, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human NOL10 (NP_079170.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KNSGKIFTSLEPEHDLNDVCLYPNSGMLLTANETPKMGIYYIPVLGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTKKDLENLGLTHLIGSPFLRAYMH | Uniprot ID | Q9BSC4 |
Uniprot Id
Q9BSC4
Target Species
Human
Target Name
NOL10
Target Full Name
Nucleolar protein 10
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
WD repeat NOL10/ENP2 family
Target Synonyms
FLJ13938; FLJ14075; H_NH0074G24.1; NOL 10; Nol10; NOL10_HUMAN; Nucleolar protein 10; Polyglutamine binding protein 5; PQBP5
Target Background
Enables RNA binding activity. Predicted to be involved in maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA). Located in nucleolus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
