Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LIN9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-470 of human LIN9 (NP_775106.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LIN9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-470 of human LIN9 (NP_775106.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07156A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LIN9 |
| Target Synonyms | TGS; BARA; TGS1; TGS2; Lin-9; BARPsv; LIN9 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-470 of human LIN9 (NP_775106.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPC | Uniprot ID | Q5TKA1 |
Uniprot Id
Q5TKA1
Target Species
Human
Target Name
LIN9
Target Full Name
Protein lin-9 homolog
Target Function
Acts as a tumor suppressor. Inhibits DNA synthesis. Its ability to inhibit oncogenic transformation is mediated through its association with RB1. Plays a role in the expression of genes required for the G1/S transition.
Target Subcellular Location
Nucleus, nucleoplasm. Note=Found in perinucleolar structures. Associated with chromatin.
Target Protein Families
Lin-9 family
Target Tissue Specificity
Expressed in thymus and testis.
Target Synonyms
BARA; Beta subunit-associated regulator of apoptosis; Beta-subunit associated regulator of apoptosis; hLin-9; huLin-9; lin-9 ; lin9; LIN9_HUMAN; pRB-associated protein; Protein lin-9 homolog; TGS; TUDOR gene similar protein; Type I interferon receptor beta chain-associated protein
Target Background
This gene encodes a tumor suppressor protein that inhibits DNA synthesis and oncogenic transformation through association with the retinoblastoma 1 protein. The encoded protein also interacts with a complex of other cell cycle regulators to repress cell cycle-dependent gene expression in non-dividing cells. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
