-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 390-480 of human TAB3 (NP_690000.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TAB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 390-480 of human TAB3 (NP_690000.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-07363A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAB3 |
| Target Synonyms | NAP1; MAP3K7IP3; TAB3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, HepG2, Mouse spleen, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 390-480 of human TAB3 (NP_690000.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QPSPRNQHSLYTATTPPSSSPSRGISSQPKPPFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAP | Uniprot ID | Q8N5C8 |
Uniprot Id
Q8N5C8
Target Species
Human
Target Name
TAB3
Target Full Name
TGF-beta-activated kinase 1 and MAP3K7-binding protein 3
Target Function
Adapter required to activate the JNK and NF-kappa-B signaling pathways through the specific recognition of 'Lys-63'-linked polyubiquitin chains by its RanBP2-type zinc finger (NZF). Acts as an adapter linking MAP3K7/TAK1 and TRAF6 to 'Lys-63'-linked polyubiquitin chains. The RanBP2-type zinc finger (NZF) specifically recognizes Lys-63'-linked polyubiquitin chains unanchored or anchored to the substrate proteins such as RIPK1/RIP1: this acts as a scaffold to organize a large signaling complex to promote autophosphorylation of MAP3K7/TAK1, and subsequent activation of I-kappa-B-kinase (IKK) core complex by MAP3K7/TAK1.; May be an oncogenic factor.
Target Tissue Specificity
Widely expressed. Constitutively overexpressed in certain tumor tissues.; [Isoform 1]: Major transcript.; [Isoform 2]: Minor transcript.
Target Synonyms
MAP3K7IP 3; Mitogen-activated protein kinase kinase kinase 7-interacting protein 3; NAP1 ; NF-kappa-B-activating protein 1; NFkB activating protein 1; TAB-3; Tab3; TAB3_HUMAN; TAK1 binding protein 3; TAK1-binding protein 3; TGF-beta-activated kinase 1 and MAP3K7-binding protein 3; TGF-beta-activated kinase 1-binding protein 3
Target Background
The product of this gene functions in the NF-kappaB signal transduction pathway. The encoded protein, and the similar and functionally redundant protein MAP3K7IP2/TAB2, forms a ternary complex with the protein kinase MAP3K7/TAK1 and either TRAF2 or TRAF6 in response to stimulation with the pro-inflammatory cytokines TNF or IL-1. Subsequent MAP3K7/TAK1 kinase activity triggers a signaling cascade leading to activation of the NF-kappaB transcription factor. The human genome contains a related pseudogene. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Notification