-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SARM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 625-724 of human SARM1 (NP_055892.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against SARM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 625-724 of human SARM1 (NP_055892.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-07515A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Sarm1 |
| Target Synonyms | SARM; HsTIR; SAMD2; hSARM1; MyD88-5; SARM1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, SH-SY5Y | Application | ELISA, WB, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 625-724 of human SARM1 (NP_055892.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRSSRDSSAGSDTSLEGAAPMGPT | Uniprot ID | Q6SZW1 |
Uniprot Id
Q6SZW1
Target Species
Human
Target Name
SARM1
Target Full Name
NAD(+) hydrolase SARM1
Target Function
NAD(+) hydrolase, which plays a key role in axonal degeneration following injury by regulating NAD(+) metabolism. Acts as a negative regulator of MYD88- and TRIF-dependent toll-like receptor signaling pathway by promoting Wallerian degeneration, an injury-induced form of programmed subcellular death which involves degeneration of an axon distal to the injury site. Wallerian degeneration is triggered by NAD(+) depletion: in response to injury, SARM1 is activated and catalyzes cleavage of NAD(+) into ADP-D-ribose (ADPR), cyclic ADPR (cADPR) and nicotinamide; NAD(+) cleavage promoting cytoskeletal degradation and axon destruction. Also able to hydrolyze NADP(+), but not other NAD(+)-related molecules. Can activate neuronal cell death in response to stress. Regulates dendritic arborization through the MAPK4-JNK pathway. Involved in innate immune response: inhibits both TICAM1/TRIF- and MYD88-dependent activation of JUN/AP-1, TRIF-dependent activation of NF-kappa-B and IRF3, and the phosphorylation of MAPK14/p38
Target Subcellular Location
Cytoplasm. Cell projection, axon. Cell projection, dendrite. Cell junction, synapse. Mitochondrion.
Target Tissue Specificity
Predominantly expressed in brain, kidney and liver. Expressed at lower level in placenta.
Target Research Area
Cell Biology
Target Synonyms
FLJ36296; KIAA0524; MyD88-5; SAM and ARM-containing protein; SAM domain-containing protein 2; SAMD2; SARM 1; SARM1; SARM1_HUMAN; Sterile alpha and Armadillo repeat protein; sterile alpha and HEAT/Armadillo motif protein; ortholog of Drosophila; sterile alpha and HEAT/Armadillo motifs-containing protein; sterile alpha and TIR motif containing 1; Sterile alpha and TIR motif-containing protein 1; Sterile alpha and TIR motifs-containing protein 1; Sterile alpha motif domain-containing protein 2; Tir-1 homolog
Notification