-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABCA8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 425-495 of human ABCA8 (NP_009099.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ABCA8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 425-495 of human ABCA8 (NP_009099.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07517A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABCA8 |
| Form | Liquid | Species Reactivity | Human, Rat |
| Isotype | IgG | Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | HeLa, HepG2, U-251MG |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 425-495 of human ABCA8 (NP_009099.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NEYGHRRPPLFFLKSSFWSQTQKTDHVALEDEMDADPSFHDSFEQAPPEFQGKEAIRIRNVTKEYKGKPDK | Uniprot ID | O94911 |
Uniprot Id
O94911
Target Species
Human
Target Name
ABCA8
Target Full Name
ABC-type organic anion transporter ABCA8
Target Function
Catalyzes ATP-dependent import of organic anions such as taurocholate and estrone sulfate. In vitro, also imports ochratoxin A. Also mediates cholesterol efflux independent of apolipoprotein, and plays a role in sphingomyelin production in oligodendrocytes.; Catalyzes ATP-dependent efflux of cholesterol and taurocholate. Interaction with ABCA1 potentiates cholesterol efflux to lipid-free APOA1, which regulates high-density lipoprotein cholesterol levels.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane.
Target Protein Families
ABC transporter superfamily, ABCA family
Target Tissue Specificity
Widely expressed with higher expression in heart, skeletal muscle and liver. Highly expressed in the superior frontal white matter and inferior temporal white matter.
Target Synonyms
ABCA8; KIAA0822ATP-binding cassette sub-family A member 8
Target Background
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. The encoded protein may regulate lipid metabolism and be involved in the formation and maintenance of myelin. Alternative splicing results in multiple transcript variants.
Notification