Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BTN2A1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 29-130 of human BTN2A1 ( NP_008980.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BTN2A1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 29-130 of human BTN2A1 ( NP_008980.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from Hep G2 cells, using BTN2A1 Rabbit pAb at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 120s.
| Cat.No | ADA-08286A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BTN2A1 |
| Target Synonyms | BTF1; BT2.1; BTN2.1; DJ3E1.1; BK14H9.1; BTN2A1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2 | Application | ELISA, WB |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 29-130 of human BTN2A1 ( NP_008980.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEG | Uniprot ID | Q7KYR7 |
Uniprot Id
Q7KYR7
Target Species
Human
Target Name
BTN2A1
Target Full Name
Butyrophilin subfamily 2 member A1
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, BTN/MOG family
Target Tissue Specificity
Highly expressed in brain, bone marrow, small intestine, muscle, spleen and pancreas. Moderate expression was seen in lung, liver and kidney.
Target Research Area
Signal Transduction
Target Synonyms
BK14H9.1; BT2.1; BT2A1_HUMAN; BTF1; BTN2A1; Butyrophilin BTF1; Butyrophilin subfamily 2 member A1; CTA-14H9.1; DJ3E1.1
Target Background
This gene encodes a member of the immunoglobulin superfamily. The gene is located in a cluster of butyrophilin-like genes in the juxta-telomeric region of the major histocompatibility complex on chromosome 6. A pseudogene of this gene has been identified in this cluster. The encoded protein is an integral plasma membrane protein involved in lipid, fatty-acid, and sterol metabolism. Alterations in this gene may be associated with several disease states including metabolic syndrome. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
