Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Chk2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Chk2 (NP_057890.1?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against Chk2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Chk2 (NP_057890.1?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of?HeLa cells using?Chk2 Rabbit pAb at?a?dilution of?1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution.?Blue: DAPI for nuclear staining.
| Cat.No | ADA-08470A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Chk2 |
| Target Synonyms | CHK2; Cds1; Rad53; HUCDS1; Chek2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Chk2 (NP_057890.1?). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | MKSHHQSHSSTSSKAHDSASCSQSQGGFSQPQGTPSQLHELSQYQGSSSSSTGTVPSSSQSSHSSSGTLSSLETVSTQELCSIPEDQEPEEPGPAPWARL | Uniprot ID | Q9Z265 |
Uniprot Id
Q9Z265
Target Synonyms
CHK2; Cds1; Rad53; HUCDS1; Chek2
Target Background
Enables protein kinase activity. Acts upstream of or within cellular response to gamma radiation; peptidyl-serine phosphorylation; and signal transduction by p53 class mediator. Predicted to be located in Golgi apparatus and PML body. Predicted to be active in cytoplasm and nucleus. Predicted to colocalize with chromosome, telomeric region. Is expressed in several structures, including central nervous system; genitourinary system; and liver. Human ortholog(s) of this gene implicated in several diseases, including Li-Fraumeni syndrome 2; breast cancer (multiple); colorectal cancer; osteosarcoma; and prostate cancer. Orthologous to human CHEK2 (checkpoint kinase 2).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
