Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Bcl9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1278-1377 of mouse Bcl9 (NP_084209.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Bcl9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1278-1377 of mouse Bcl9 (NP_084209.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08472A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BCL9 |
| Target Synonyms | Gm130; 2610202E01Rik; 8030475K17Rik; A330041G23Rik; Bcl9 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, Karpas 299 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1278-1377 of mouse Bcl9 (NP_084209.3). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | DQAPRMGLALPGMGGPGPVGTPDIPLGTSPSMPGHNPMRPPAFLQQGMMGPHHRMMSPAQSTVPGPATLMTNPAAAVGMIPGKDRGPAGLYTHPGPVGSP | Uniprot ID | Q9D219 |
Uniprot Id
Q9D219
Target Synonyms
Gm130; 2610202E01Rik; 8030475K17Rik; A330041G23Rik; Bcl9
Target Background
Enables beta-catenin binding activity. Acts upstream of or within several processes, including myotube differentiation involved in skeletal muscle regeneration; skeletal muscle cell differentiation; and somatic stem cell population maintenance. Located in cis-Golgi network and nucleus. Is expressed in several structures, including brain; eye; head surface ectoderm; metanephros; and thymus primordium. Orthologous to human BCL9 (BCL9 transcription coactivator).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
