-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DDR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-400 of human DDR2 (NP_001014796.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DDR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-400 of human DDR2 (NP_001014796.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08979A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DDR2 |
| Target Synonyms | TKT; WRCN; MIG20a; NTRKR3; TYRO10; DDR2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, A375, HT-1080, Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 290-400 of human DDR2 (NP_001014796.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRI | Uniprot ID | Q16832 |
Uniprot Id
Q16832
Target Species
Human
Target Name
DDR2
Target Full Name
Discoidin domain-containing receptor 2
Target Function
Tyrosine kinase involved in the regulation of tissues remodeling. It functions as cell surface receptor for fibrillar collagen and regulates cell differentiation, remodeling of the extracellular matrix, cell migration and cell proliferation. Required for normal bone development. Regulates osteoblast differentiation and chondrocyte maturation via a signaling pathway that involves MAP kinases and leads to the activation of the transcription factor RUNX2. Regulates remodeling of the extracellular matrix by up-regulation of the collagenases MMP1, MMP2 and MMP13, and thereby facilitates cell migration and tumor cell invasion. Promotes fibroblast migration and proliferation, and thereby contributes to cutaneous wound healing.
Target Involvement
Spondyloepimetaphyseal dysplasia short limb-hand type (SEMD-SL)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, Insulin receptor subfamily
Target Tissue Specificity
Detected in osteocytes, osteoblastic cells in subchondral bone, bone lining cells, tibia and cartilage (at protein level). Detected at high levels in heart and lung, and at low levels in brain, placenta, liver, skeletal muscle, pancreas, and kidney.
Target Synonyms
CD167 antigen-like family member B; CD167b; CD167b antigen; Cell migration inducing protein 20; DDR 2; DDR2; DDR2_HUMAN; Discoidin domain containing receptor 2; Discoidin domain receptor 2; Discoidin domain receptor family member 2; discoidin domain receptor tyrosine kinase 2; Discoidin domain-containing receptor 2; discoidin domain-containing receptor tyrosine kinase 2; Hydroxyaryl protein kinase; MIG20a; Migration inducing gene 16 protein; Neurotrophic tyrosine kinase; Neurotrophic tyrosine kinase receptor related 3; NTRKR 3; NTRKR3; Receptor protein tyrosine kinase TKT; Receptor protein-tyrosine kinase TKT; Receptor related 3; receptor-related 3; TKT; TYRO 10; TYRO10; Tyrosine kinase receptor related to neurotrophic TRK; Tyrosine protein kinase TYRO 10; Tyrosine protein kinase TYRO10; Tyrosine-protein kinase TYRO10; Tyrosylprotein kinase
Target Background
This gene encodes a member of the discoidin domain receptor subclass of the receptor tyrosine kinase (RTKs) protein family. RTKs play a key role in the communication of cells with their microenvironment. The encoded protein is a collagen-induced receptor that activates signal transduction pathways involved in cell adhesion, proliferation, and extracellular matrix remodeling. This protein is expressed in numerous cell types and may alos be involved in wound repair and regulate tumor growth and invasiveness. Mutations in this gene are the cause of short limb-hand type spondylometaepiphyseal dysplasia.
Notification