-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PALB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 99-198 of human PALB2 (NP_078951.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PALB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 99-198 of human PALB2 (NP_078951.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09058A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PALB2 |
| Target Synonyms | FANCN; PNCA3; PALB2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 99-198 of human PALB2 (NP_078951.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLDVGPESFNPGDGPGGLPIQRTDDTQEHFPHRVSDPSGEQKQKLPSRRKKQQKRTFISQERDCVFGTDSLRLSGKRLKEQEEISSKNPARSPVTEIRTH | Uniprot ID | Q86YC2 |
Uniprot Id
Q86YC2
Target Species
Human
Target Name
PALB2
Target Full Name
Partner and localizer of BRCA2
Target Function
Plays a critical role in homologous recombination repair (HRR) through its ability to recruit BRCA2 and RAD51 to DNA breaks. Strongly stimulates the DNA strand-invasion activity of RAD51, stabilizes the nucleoprotein filament against a disruptive BRC3-BRC4 polypeptide and helps RAD51 to overcome the suppressive effect of replication protein A (RPA). Functionally cooperates with RAD51AP1 in promoting of D-loop formation by RAD51. Serves as the molecular scaffold in the formation of the BRCA1-PALB2-BRCA2 complex which is essential for homologous recombination. Via its WD repeats is proposed to scaffold a HR complex containing RAD51C and BRCA2 which is thought to play a role in HR-mediated DNA repair. Essential partner of BRCA2 that promotes the localization and stability of BRCA2. Also enables its recombinational repair and checkpoint functions of BRCA2. May act by promoting stable association of BRCA2 with nuclear structures, allowing BRCA2 to escape the effects of proteasome-mediated degradation. Binds DNA with high affinity for D loop, which comprises single-stranded, double-stranded and branched DNA structures. May play a role in the extension step after strand invasion at replication-dependent DNA double-strand breaks; together with BRCA2 is involved in both POLH localization at collapsed replication forks and DNA polymerization activity.
Target Involvement
Breast cancer (BC); Fanconi anemia complementation group N (FANCN); Pancreatic cancer 3 (PNCA3)
Target Subcellular Location
Nucleus.
Target Synonyms
4732427B05; BC066140; DKFZp667I166; DKFZp686E1054; FANCN; FANCN GENE; FLJ21816; OTTMUSP00000025884; PALB2; PALB2_HUMAN; Partner and localizer of BRCA2; PNCA3; RGD1304759
Target Background
This gene encodes a protein that may function in tumor suppression. This protein binds to and colocalizes with the breast cancer 2 early onset protein (BRCA2) in nuclear foci and likely permits the stable intranuclear localization and accumulation of BRCA2.
Notification