Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCKAR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CCKAR (NP_000721.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CCKAR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CCKAR (NP_000721.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09114A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCKAR |
| Target Synonyms | CCK-A; CCK1R; CCKRA; CCK1-R; CCKAR | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse stomach | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CCKAR (NP_000721.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLL | Uniprot ID | P32238 |
Uniprot Id
P32238
Target Species
Human
Target Name
CCKAR
Target Full Name
Cholecystokinin receptor type A
Target Function
Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Synonyms
CCKAR; CCKRA; Cholecystokinin receptor type A; CCK-A receptor; CCK-AR; Cholecystokinin-1 receptor; CCK1-R
Target Background
This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallbladder and stomach. In the central and peripheral nervous system this receptor regulates satiety and the release of beta-endorphin and dopamine.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
