-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TFAP2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TFAP2B (Q92481) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TFAP2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TFAP2B (Q92481) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09166A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TFAP2B |
| Target Synonyms | PDA2; AP-2B; AP2-B; AP-2beta; TFAP2B | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y, U-937(Negative control) | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TFAP2B (Q92481). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHTPSSDFQPPYFPPPYQPLPYHQSQDPYSHVNDPYSLNPLHQ | Uniprot ID | Q92481 |
Uniprot Id
Q92481
Target Species
Human
Target Name
TFAP2B
Target Full Name
Transcription factor AP-2-beta
Target Function
Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-beta appears to be required for normal face and limb development and for proper terminal differentiation and function of renal tubular epithelia.
Target Involvement
Char syndrome (CHAR); Patent ductus arteriosus 2 (PDA2)
Target Subcellular Location
Nucleus.
Target Protein Families
AP-2 family
Target Synonyms
Activating enhancer binding protein 2 beta; Activating enhancer-binding protein 2-beta; AP 2B; AP2 B; AP2-beta; AP2B; AP2B_HUMAN; AP2beta; MGC21381; OTTHUMP00000039925; PDA2; TFAP 2B; Tfap2b; Transcription factor AP 2 beta; Transcription factor AP-2-beta; Transcription factor AP2 beta
Target Background
This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives.
Notification