Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF148 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 690-794 of human ZNF148 (NP_068799.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ZNF148 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 690-794 of human ZNF148 (NP_068799.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09394A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF148 |
| Target Synonyms | BERF-1; BFCOL1; GDACCF; ZBP-89; ZFP148; pHZ-52; HT-BETA; ZNF148 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse lung, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 690-794 of human ZNF148 (NP_068799.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG | Uniprot ID | Q9UQR1 |
Uniprot Id
Q9UQR1
Target Species
Human
Target Name
ZNF148
Target Full Name
Zinc finger protein 148
Target Function
Involved in transcriptional regulation. Represses the transcription of a number of genes including gastrin, stromelysin and enolase. Binds to the G-rich box in the enhancer region of these genes.
Target Involvement
Global developmental delay, absent or hypoplastic corpus callosum, and dysmorphic facies (GDACCF)
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Synonyms
Transcription factor ZBP-89; Transcription factor ZBP89; ZBP89; Zinc finger DNA binding protein 89; Zinc finger DNA-binding protein 89; Zinc finger protein 148; ZN148_HUMAN; ZNF 148; ZNF148
Target Background
The protein encoded by this gene is a member of the Kruppel family of zinc finger DNA binding proteins. The encoded protein activates transcription of the T-cell receptor and intestinal alkaline phosphatase genes but represses transcription of the ornithine decarboxylase, vimentin, gastrin, stomelysin, and enolase genes. Increased expression of this gene results in decreased patient survival rates from colorectal cancer, while mutations in this gene have been associated with global developmental delay, hypoplastic corpus callosum, and dysmorphic facies.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
