-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FABP6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human FABP6 (NP_001436.1)) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against FABP6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human FABP6 (NP_001436.1)) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09412A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FABP6 |
| Target Synonyms | ILBP; I-15P; I-BAP; ILBP3; ILLBP; I-BABP; I-BALB; FABP6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A375, MCF7 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human FABP6 (NP_001436.1)). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA | Uniprot ID | P51161 |
Uniprot Id
P51161
Target Species
Human
Target Name
FABP6
Target Full Name
Gastrotropin
Target Function
Binds to bile acids and is involved in enterohepatic bile acid metabolism. Required for efficient apical to basolateral transport of conjugated bile acids in ileal enterocytes. In vitro binds to bile acids in the order: deoxycholic acid > cholic acid > chenodeoxycholic acid and respective BA conjugation modifies affinities in the order taurine-conjugated > glycine-conjugated > unconjugated bile acids. Stimulates gastric acid and pepsinogen secretion.; Essential for the survival of colon cancer cells to bile acid-induced apoptosis.
Target Subcellular Location
[Isoform 1]: Cytoplasm. Membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 2]: Cytoplasm.
Target Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Target Tissue Specificity
Isoform 1 is expressed in the jejunum, ileum, cecum and ascending colon intestine. Isoform 2 is xpressed in the gallbladder, duodenum, jejunum, ileum, cecum, ascending, transverse and descending colon, sigmoid colon and rectum. Isoform 2 is expressed in c
Target Research Area
Signal Transduction
Target Synonyms
Fabp6; FABP6_HUMAN; Fatty acid binding protein 6; ileal (gastrotropin) ; Fatty acid-binding protein 6; Gastrotropin; GT; I 15P; I BABP ; I BALB; I BAP; I-15P; I-BABP; I15P; IBABP ; IBALB; IBAP; ILBP; ILBP3 ; Ileal lipid binding protein; Ileal lipid-binding protein; ILLBP ; Intestinal 15 kDa protein; Intestinal bile acid binding protein; Intestinal bile acid-binding protein
Target Background
This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene.
Notification