-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FOXP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 590-715 of human FOXP2 (NP_055306.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FOXP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 590-715 of human FOXP2 (NP_055306.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09663A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FOXP2 |
| Target Synonyms | SPCH1; CAGH44; TNRC10; FOXP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, Mouse lung, SGC-7901, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 590-715 of human FOXP2 (NP_055306.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GSPTLVKNIPTSLGYGAALNASLQAALAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE | Uniprot ID | O15409 |
Uniprot Id
O15409
Target Species
Human
Target Name
FOXP2
Target Full Name
Forkhead box protein P2
Target Function
Transcriptional repressor that may play a role in the specification and differentiation of lung epithelium. May also play a role in developing neural, gastrointestinal and cardiovascular tissues. Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential. Plays a role in synapse formation by regulating SRPX2 levels. Involved in neural mechanisms mediating the development of speech and language.
Target Involvement
Speech-language disorder 1 (SPCH1)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Isoform 1 and isoform 6 are expressed in adult and fetal brain, caudate nucleus and lung.
Target Synonyms
CAG repeat protein 44; CAGH44 ; DKFZp686H1726; Forkhead box P2 ; Forkhead box protein P2; forkhead/winged-helix transcription factor; FOX P2; FOXP2; FOXP2_HUMAN; HGNC11222 ; HGNC11956 ; SPCH 1; SPCH1 ; TNRC 10; TNRC10 ; trinucleotide repeat containing 10; Trinucleotide repeat containing gene 10 protein; Trinucleotide repeat-containing gene 10 protein
Target Background
This gene encodes a member of the forkhead/winged-helix (FOX) family of transcription factors. It is expressed in fetal and adult brain as well as in several other organs such as the lung and gut. The protein product contains a FOX DNA-binding domain and a large polyglutamine tract and is an evolutionarily conserved transcription factor, which may bind directly to approximately 300 to 400 gene promoters in the human genome to regulate the expression of a variety of genes. This gene is required for proper development of speech and language regions of the brain during embryogenesis, and may be involved in a variety of biological pathways and cascades that may ultimately influence language development. Mutations in this gene cause speech-language disorder 1 (SPCH1), also known as autosomal dominant speech and language disorder with orofacial dyspraxia. Multiple alternative transcripts encoding different isoforms have been identified in this gene.
Notification