-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FOXC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 404-553 of human FOXC1 (NP_001444.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FOXC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 404-553 of human FOXC1 (NP_001444.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09837A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FOXC1 |
| Target Synonyms | ARA; IGDA; IHG1; ASGD3; FKHL7; IRID1; RIEG3; FREAC3; FREAC-3; FOXC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, Jurkat, Mouse lung, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 404-553 of human FOXC1 (NP_001444.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AAGERGGHLQGAPGGAGGSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF | Uniprot ID | Q12948 |
Uniprot Id
Q12948
Target Species
Human
Target Name
FOXC1
Target Full Name
Forkhead box protein C1
Target Function
DNA-binding transcriptional factor that plays a role in a broad range of cellular and developmental processes such as eye, bones, cardiovascular, kidney and skin development. Acts either as a transcriptional activator or repressor. Binds to the consensus binding site 5'-[G/C][A/T]AAA[T/C]AA[A/C]-3' in promoter of target genes. Upon DNA-binding, promotes DNA bending. Acts as a transcriptional coactivator. Stimulates Indian hedgehog (Ihh)-induced target gene expression mediated by the transcription factor GLI2, and hence regulates endochondral ossification. Acts also as a transcriptional coregulator by increasing DNA-binding capacity of GLI2 in breast cancer cells. Regulates FOXO1 through binding to a conserved element, 5'-GTAAACAAA-3' in its promoter region, implicating FOXC1 as an important regulator of cell viability and resistance to oxidative stress in the eye. Cooperates with transcription factor FOXC2 in regulating expression of genes that maintain podocyte integrity. Promotes cell growth inhibition by stopping the cell cycle in the G1 phase through TGFB1-mediated signals. Involved in epithelial-mesenchymal transition (EMT) induction by increasing cell proliferation, migration and invasion. Involved in chemokine CXCL12-induced endothelial cell migration through the control of CXCR4 expression. Plays a role in the gene regulatory network essential for epidermal keratinocyte terminal differentiation. Essential developmental transcriptional factor required for mesoderm-derived tissues, such as the somites, skin, bone and cartilage. Positively regulates CXCL12 and stem cell factor expression in bone marrow mesenchymal progenitor cells, and hence plays a role in the development and maintenance of mesenchymal niches for haematopoietic stem and progenitor cells (HSPC). Plays a role in corneal transparency by preventing both blood vessel and lymphatic vessel growth during embryonic development in a VEGF-dependent manner. Involved in chemokine CXCL12-induced endothelial cell migration through the control of CXCR4 expression. May function as a tumor suppressor.
Target Involvement
Axenfeld-Rieger syndrome 3 (RIEG3); Anterior segment dysgenesis 3 (ASGD3)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in keratinocytes of epidermis and hair follicle. Expressed strongly in microvascular invasion (MVI) formation, basal-like breast cancer (BLBC) and hepatocellular tumors. Expressed in breast cancers (at protein level). Expressed in hematopoietic
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
ARA; FKH L7; FKHL 7; FKHL7; Forkhead (Drosophila) like 7; Forkhead box C1; Forkhead box protein C1; Forkhead drosophila homolog like 7; Forkhead like 7; Forkhead related activator 3; Forkhead related protein FKHL7; Forkhead related transcription factor 3; Forkhead-related protein FKHL7; Forkhead-related transcription factor 3; FOX C1; FOXC 1; Foxc1; FOXC1_HUMAN; FREAC 3; FREAC-3; FREAC3; IGDA; IHG 1; IHG1; IRID 1; IRID1; Iridogoniodysgenesis type 1; Myeloid factor delta
Target Background
This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly.
Notification