Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ORMDL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ORMDL3 (NP_644809.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ORMDL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ORMDL3 (NP_644809.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10156A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ORMDL3 |
| Target Synonyms | ORMDL3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse eye, Mouse liver, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ORMDL3 (NP_644809.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRK | Uniprot ID | Q8N138 |
Uniprot Id
Q8N138
Target Species
Human
Target Name
ORMDL3
Target Full Name
ORM1-like protein 3
Target Function
Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling.
Target Involvement
Asthma (ASTHMA)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
ORM family
Target Tissue Specificity
Widely expressed. Expressed in adult and fetal heart, brain, lung, liver, skeletal muscle and kidney. Expressed in adult pancreas and placenta and in fetal spleen abd thymus.
Target Synonyms
ORMDL3; ORM1-like protein 3
Target Background
Involved in ceramide metabolic process. Acts upstream of or within several processes, including negative regulation of B cell apoptotic process; negative regulation of ceramide biosynthetic process; and positive regulation of protein localization to nucleus. Located in endoplasmic reticulum. Part of SPOTS complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
