-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Histone H1.4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H14 (NP_005312.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Histone H1.4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H14 (NP_005312.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10530A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Histone H1.4 |
| Target Synonyms | H1E; H1.4; H1F4; RMNS; H1s-4; HIST1H1E; dJ221C16.5; Histone H1.4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H14 (NP_005312.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTG | Uniprot ID | P10412 |
Uniprot Id
P10412
Target Species
Human
Target Name
H1-4
Target Full Name
Histone H1.4
Target Function
Histone H1 protein binds to linker DNA between nucleosomes forming the macromolecular structure known as the chromatin fiber. Histones H1 are necessary for the condensation of nucleosome chains into higher-order structured fibers. Acts also as a regulator of individual gene transcription through chromatin remodeling, nucleosome spacing and DNA methylation.
Target Involvement
Rahman syndrome (RMNS)
Target Subcellular Location
Nucleus. Chromosome. Note=Mainly localizes in heterochromatin. Dysplays a punctuate staining pattern in the nucleus.
Target Protein Families
Histone H1/H5 family
Target Synonyms
H1 histone family member 4; H1.4; H14_HUMAN; H1E; H1F4; Hist1h1e; Histone 1 H1e; Histone cluster 1 H1e; Histone H1; Histone H1.4; Histone H1B; MGC116819
Target Background
Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.
Notification