Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EBF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-591 of human EBF1 (NP_076870.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EBF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-591 of human EBF1 (NP_076870.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11137A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EBF1 |
| Target Synonyms | EBF; COE1; OLF1; O/E-1; EBF1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Daudi, Raji | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-591 of human EBF1 (NP_076870.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM | Uniprot ID | Q9UH73 |
Uniprot Id
Q9UH73
Target Synonyms
EBF; COE1; OLF1; O/E-1; EBF1
Target Background
Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within positive regulation of transcription, DNA-templated. Predicted to be located in nucleus. Predicted to be part of chromatin.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
