-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC17A7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 461-560 of human SLC17A7 (NP_064705.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SLC17A7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 461-560 of human SLC17A7 (NP_064705.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11141A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC17A7 |
| Target Synonyms | BNPI; VGLUT1; SLC17A7 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 461-560 of human SLC17A7 (NP_064705.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY | Uniprot ID | Q9P2U7 |
Uniprot Id
Q9P2U7
Target Species
Human
Target Name
SLC17A7
Target Full Name
Vesicular glutamate transporter 1
Target Function
Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate.
Target Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane. Membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.
Target Protein Families
Major facilitator superfamily, Sodium/anion cotransporter family, VGLUT subfamily
Target Tissue Specificity
Expressed in several regions of the brain including amygdala, cerebellum, cerebral cortex, hippocampus, frontal lobe, medulla, occipital lobe, putamen and temporal lobe.
Target Synonyms
BNPI; Brain specific Na (+) dependent inorganic phosphate cotransporter; Brain specific Na dependent inorganic phosphate cotransporter; Brain-specific Na(+)-dependent inorganic phosphate cotransporter; Slc17a7; Solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter); member 7; Solute carrier family 17 member 7; Vesicular glutamate transporter 1; VGLU1_HUMAN; VGLUT 1; VGluT1
Target Background
The protein encoded by this gene is a vesicle-bound, sodium-dependent phosphate transporter that is specifically expressed in the neuron-rich regions of the brain. It is preferentially associated with the membranes of synaptic vesicles and functions in glutamate transport. The protein shares 82% identity with the differentiation-associated Na-dependent inorganic phosphate cotransporter and they appear to form a distinct class within the Na+/Pi cotransporter family.
Notification