Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TOMM40 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TOMM40 (NP_001122389.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TOMM40 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TOMM40 (NP_001122389.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11253A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TOMM40 |
| Target Synonyms | TOM40; PEREC1; C19orf1; PER-EC1; D19S1177E; TOMM40 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, Mouse brain, Mouse testis, U-2OS | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TOMM40 (NP_001122389.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKC | Uniprot ID | O96008 |
Uniprot Id
O96008
Target Species
Human
Target Name
TOMM40
Target Full Name
Mitochondrial import receptor subunit TOM40 homolog
Target Function
Channel-forming protein essential for import of protein precursors into mitochondria. Plays a role in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by forming a complex with BCAP31 and mediating the translocation of Complex I components from the cytosol to the mitochondria.
Target Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Target Protein Families
Tom40 family
Target Research Area
Tags & Cell Markers
Target Synonyms
C19orf1; D19S1177E; Haymaker protein; Mitochondrial import receptor subunit TOM40 homolog; Mitochondrial outer membrane protein; Mitochondrial outer membrane protein TOM40; p38.5; PER EC1; PEREC1; Probable mitochondrial import receptor subunit TOM40 homolog; Protein Haymaker; TOM40; TOM40_HUMAN; TOMM40; Translocase of outer membrane 40 kDa subunit homolog; Translocase of outer mitochondrial membrane 40; Translocase of outer mitochondrial membrane 40 homolog (yeast); Translocase of outer mitochondrial membrane 40 homolog; Translocase of outer mitochondrial membrane 40, yeast, homolog of
Target Background
The protein encoded by this gene is localized in the outer membrane of the mitochondria. It is the channel-forming subunit of the translocase of the mitochondrial outer membrane (TOM) complex that is essential for import of protein precursors into mitochondria. Alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
