-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FANCD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 540-720 of FANCD2 (NP_001018125.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against FANCD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 540-720 of FANCD2 (NP_001018125.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-04412A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FANCD2 |
| Target Synonyms | FA4; FAD; FACD; FAD2; FA-D2; FANCD; FANCD2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Jurkat, K-562, MCF7 | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 540-720 of FANCD2 (NP_001018125.1). | Immunogen Sequence | AFSKQNEASSHIQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGIMAADRSESPSLTQERANLSDEQCTQVTSLLQLVHSCSEQSPQASALYYDEFANLIQHEKLDPKALEWVGHTICNDFQDAFVVDSCVVPEGDFPFPVKALYGLEEYDTQDGIAINLLPLLFSQDFAKDGGPVTSQES |
|---|---|---|---|
| Uniprot ID | Q9BXW9 |
Uniprot Id
Q9BXW9
Target Species
Human
Target Name
FANCD2
Target Full Name
Fanconi anemia group D2 protein
Target Function
Required for maintenance of chromosomal stability. Promotes accurate and efficient pairing of homologs during meiosis. Involved in the repair of DNA double-strand breaks, both by homologous recombination and single-strand annealing. May participate in S phase and G2 phase checkpoint activation upon DNA damage. Plays a role in preventing breakage and loss of missegregating chromatin at the end of cell division, particularly after replication stress. Required for the targeting, or stabilization, of BLM to non-centromeric abnormal structures induced by replicative stress. Promotes BRCA2/FANCD1 loading onto damaged chromatin. May also be involved in B-cell immunoglobulin isotype switching.
Target Involvement
Fanconi anemia complementation group D2 (FANCD2)
Target Subcellular Location
Nucleus. Note=Concentrates in nuclear foci during S phase and upon genotoxic stress. At the onset of mitosis, excluded from chromosomes and diffuses into the cytoplasm, returning to the nucleus at the end of cell division. Observed in a few spots localized in pairs on the sister chromatids of mitotic chromosome arms and not centromeres, one on each chromatids. These foci coincide with common fragile sites and could be sites of replication fork stalling. The foci are frequently interlinked through BLM-associated ultra-fine DNA bridges. Following aphidicolin treatment, targets chromatid gaps and breaks.
Target Tissue Specificity
Highly expressed in germinal center cells of the spleen, tonsil, and reactive lymph nodes, and in the proliferating basal layer of squamous epithelium of tonsil, esophagus, oropharynx, larynx and cervix. Expressed in cytotrophoblastic cells of the placent
Target Synonyms
DKFZp762A223; FA 4; FA D2; FA4; FAC D2; FACD 2; FACD; FACD2; FACD2_HUMAN; FAD; FAD2; FANC D2; FANCD 2; FANCD; FANCD2; FANCONI ANEMIA COMPLEMENTATION GROUP D; Fanconi anemia complementation group D2; Fanconi anemia group D2 protein; FANCONI PANCYTOPENIA TYPE 4; FLJ23826; OTTHUMP00000158853; OTTHUMP00000207925; Protein FACD2; Type 4 Fanconi pancytopenia
Target Background
The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group D2. This protein is monoubiquinated in response to DNA damage, resulting in its localization to nuclear foci with other proteins (BRCA1 AND BRCA2) involved in homology-directed DNA repair. Alternative splicing results in multiple transcript variants.
Notification