-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GSDMA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 61-181 human GSDMA(NP_835465.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GSDMA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 61-181 human GSDMA(NP_835465.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16369A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GSDMA |
| Target Synonyms | GSDM; FKSG9; GSDM1; GSDMA | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | COLO 205 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 61-181 human GSDMA(NP_835465.2). | Immunogen Sequence | LDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETVQERKLAADHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFF |
|---|---|---|---|
| Uniprot ID | Q96QA5 |
Uniprot Id
Q96QA5
Target Species
Human
Target Name
GSDMA
Target Full Name
Gasdermin-A
Target Function
This form constitutes the precursor of the pore-forming protein: upon cleavage, the released N-terminal moiety (Gasdermin-A, N-terminal) binds to membranes and forms pores, triggering cell death.; Pore-forming protein that causes membrane permeabilization and pyroptosis. Released upon cleavage in vitro of genetically engineered GSDMA, and binds to membrane inner leaflet lipids. Homooligomerizes within the membrane and forms pores of 10-15 nanometers (nm) of inner diameter, triggering pyroptosis. Binds to membrane inner leaflet lipids, such as phosphatidylinositol (4,5)-bisphosphate. The functional mechanisms and physiological proteases that cleave and activate this pore-forming protein are unknown.
Target Subcellular Location
[Gasdermin-A]: Cytoplasm, perinuclear region. Cytoplasm, cytosol.; [Gasdermin-A, N-terminal]: Cell membrane; Multi-pass membrane protein.
Target Protein Families
Gasdermin family
Target Tissue Specificity
Expressed predominantly in the gastrointestinal tract and, at a lower level, in the skin. Also detected in mammary gland. In the gastrointestinal tract, mainly expressed in differentiated cells, including the differentiated cell layer of esophagus and muc
Target Research Area
Cell Biology
Target Synonyms
GSDMA; GSDM; GSDM1; FKSG9Gasdermin-A; Gasdermin-1
Target Background
Predicted to enable phosphatidylinositol-4, 5-bisphosphate binding activity; phosphatidylinositol-4-phosphate binding activity; and phosphatidylserine binding activity. Involved in apoptotic process. Located in perinuclear region of cytoplasm.
Notification