Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against A4GALT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 244-353 of human A4GALT (NP_059132.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against A4GALT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 244-353 of human A4GALT (NP_059132.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01098A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | A4GALT |
| Target Synonyms | P1; PK; Gb3S; P(k); P1PK; A14GALT; A4GALT1; A4GALT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, A375, LO2, Mouse brain, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 244-353 of human A4GALT (NP_059132.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WIWGHQGPQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL | Uniprot ID | Q9NPC4 |
Uniprot Id
Q9NPC4
Target Species
Human
Target Name
A4GALT
Target Full Name
Lactosylceramide 4-alpha-galactosyltransferase
Target Function
Catalyzes the transfer of galactose from UDP-alpha-D-galactose to lactosylceramide/beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide(d18:1(4E)) to produce globotriaosylceramide/globoside Gb3Cer (d18:1(4E)). Also able to transfer galactose to galactosylceramide/beta-D-Gal-(1<->1')-Cer. Globoside Gb3Cer is a glycosphingolipid of the globo serie, one of the major types of neutral root structures of glycosphingolipids, that constitute a significant portion of mammalian cell membranes. Globotriaosylceramide/globoside Gb3Cer in blood and tissue cell membranes is the antigen Pk of blood histogroup P.; (Microbial infection) Globotriaosylceramide is one of the cellular ligands for bacterial verotoxins.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 32 family
Target Tissue Specificity
Ubiquitous. Highly expressed in kidney, heart, spleen, liver, testis and placenta.
Target Synonyms
4 N acetylglucosaminyltransferase; 4-galactosyltransferase; 4-N-acetylglucosaminyltransferase; A14GALT; A4GALT; A4GALT1; A4GAT_HUMAN; Alpha 1 4 galactosyltransferase; Alpha 1 4 N acetylglucosaminyltransferase; Alpha-1; Alpha4Gal T1; Alpha4Gal-T1; CD77 synthase; Gb3 synthase; Gb3S; Globotriaosylceramide synthase; Lactosylceramide 4 alpha galactosyltransferase; Lactosylceramide 4-alpha-galactosyltransferase; P blood group (P one antigen); P(k) antigen synthase; P1; P1/Pk synthase; PK; UDP galactose beta D galactosyl beta1 R 4 alpha D galactosyltransferase; UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase
Target Background
The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. This protein, a type II membrane protein found in the Golgi, is also required for the synthesis of the bacterial verotoxins receptor. Alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
